Share |

Home
| About Us | Testimonials | India Travel Tips | Our Expertise | Disclaimer | Contact Us | Enquiry Form   

Prudent Networks Tours & Travel agency
Prudent NetworksPrudent Networks
 
Rajasthan Tour Packages

Rajasthan Tour Packages

Incredible Tourism India...
Kerala Tours Packages

Kerala Tours Packages

Kerala, God's Own Country...
South India Tours

South India Tours

Place of Temples...
Taj Mahal Tourism

Taj Mahal Tourism

Symbol of Love...
Luxury Tours India

Luxury Tours India

Enjoy Your Stay in India...
Wildlife Tours in India

Wildlife Tours in India

Find Flora & Fauna of India...
Luxury Trains in India

Luxury Trains in India

Royal Coaches of Maharajas...
Honeymoon Tours

Honeymoon Tours

Romantic Experience of Life...
Monuments in India

Monuments in India

Taj Mahal Seven Wonder...
Luxury Hotels In India

Luxury Hotels In India

Enjoy Luxury Stay in India...
Our Expertise Tour Packages
Tours to India
Luxury Tours
(19 Nights/20 Days)
 
Tours to India
Adventure Tours
(09 Nights/08 Days)
 
Tours to India
India Wildlife Tours
(15 Nights/16 Days)
 
Tours to India
Rajasthan Tours
(13 Nights/14 Days)
 
Tours to India
Luxury Train Tours
 
Tours to India
South India Tours
(20 Nights/21 Days)
 
Tours to India
Pilgrimage Tours
(10 Nights/11 Days)
 
Tours to India
Tours Around India
 
Tours to India
Culture Tours India
(20 Nights/21 Days)
 
Tours to India
Kerala Tours
(07 Nights/08 Days)
 
Tours to India
Heritage Tours
(18 Nights/19 Days)
 
Tours to India
Golden Triangle Tours
(04 Nights/05 Days)
 
 More...

>> Most Famous Travel Cities

DelhiAgra
Tours to India Delhi    Tours to India Agra
JaipurUdaipur
Tours to India Jaipur   Tours to India Udaipur


Family Vacations
Home » Disclaimer

Disclaimer

A. User expressly agrees that use of prudentnetworks.com is at user's sole risk. Neither prudentnetworks.com, its affiliates nor any of their respective employees, agents, third party content providers or licensors warrant that prudentnetworks.com will be uninterrupted or error free; nor do they make any warranty as to the results that may be obtained from use of prudentnetworks.com, or as to the accuracy, reliability or content of any information, service, or merchandise provided through prudentnetworks.com.

B.
Prudentnetworks.com is provided on an "as is" basis without warranties of any kind, either express or implied, including, but not limited to, warranties of title or implied warranties of merchantability or fitness for a particular purpose, other than those warranties which are implied by and incapable of exclusion, restriction or modification under the laws applicable to this agreement.

C. This disclaimer of liability applies to any damages or injury caused by any failure of performance, error, omission, interruption, deletion, defect, delay in operation or transmission, computer virus, communication line failure, theft or destruction or unauthorized access to, alteration of, or use of record, whether for breach of contract, tortuous behavior, negligence, or under any other cause of action. prudentnetworks.com does not warrant that defects would be corrected or make any representations regarding the use or the results of the use of the materials in this site in terms of their correctness, accuracy, reliability, or otherwise. You (and not prudentnetworks.com) assume the entire cost of all necessary servicing, repair or correction, applicable law may not allow the exclusion of implied warranties, so the above exclusion may not apply to you. User specifically acknowledges that prudentnetworks.com is not liable for the defamatory, offensive or illegal conduct of other users or third-parties and that the risk of injury from the foregoing rests entirely with user.

D. In no event will prudentnetworks.com, or any person or entity involved in creating, producing or distributing prudentnetworks.com or the prudentnetworks.com software, be liable for any damages, including, without limitation, direct, indirect, incidental, special, consequential or punitive damages arising out of the use of or inability to use prudentnetworks.com user hereby acknowledges that the provisions of this section shall apply to all content on prudentnetworks.com.

E. In addition to the terms set forth above, neither prudentnetworks.com, nor its affiliates, information providers or content partners shall be liable regardless of the cause or duration, for any errors, inaccuracies, omissions, or other defects in, or untimeliness or unauthenticity of, the information contained within prudentnetworks.com, or for any delay or interruption in the transmission thereof to the user, or for any claims or losses arising therefrom or occasioned thereby. None of the foregoing parties shall be liable for any third-party claims or losses of any nature, including, but not limited to, lost profits, punitive or consequential damages. Neither prudentnetworks.com nor its affiliates, information providers or content providers warrant or guarantee the timeliness, sequence, accuracy or completeness of this information. Additionally, there are no warranties as to the results obtained from the use of the information.

Testimonials

Monuments of IndiaMonuments of India Monuments of India
India is a land rich in monumental
heritage. The monuments of India
not only showcase the breathtaking architec...
Tours to IndiaTaj Mahal Agra
Tours to IndiaRed Fort DelhiMore...
Taj Mahal Agra
Surf India by Theme
Tours to IndiaHoneymoon Tour Packages
Tours to IndiaCultural Tour Packages
Tours to IndiaAdventure Tour Packages
Tours to IndiaYoga, Ayurveda & Spa Tours
Tours to IndiaLuxury Train Tours India
Tours to IndiaReligious & Spiritual Tours
Tours to IndiaBeaches Tour Packages
Tours to IndiaWildlife Safari Tours
Tours to IndiaBuddhist Tour Packages
 More...

Call Me

Quick Booking Form
Name

Country

Phone

Email

How can we help?


Enter the Code Shown Above

Travel Tools
  • Distance Calculator
  • Weather Update
  • Currency Converter
  • Railway Timetable
  • Airlines Timetable
  •  
    - We are very pleased with the tour we did with your
    company. - Myriam

    - All the hotels have been highly satisfactory -
    A.P.M Ferlin Jayatissu
    Clients Testimonials
    ABOUT PRUDENT
    Home
    About Us
    Testimonials
    India Travel Tips
    Our Expertise
    Disclaimer
    Sitemap
    XML Sitemap
    Our Network Sites
    Contact Us
    Enquiry Form
    PRUDENT SERVICES
    India Tour Packages
    Most Famous Travel Cities
    Luxury Hotels in India
    Our Expertise Tour Packages
    Monuments in India
    Surf India by Theme
    CONTACT US   
    Prudent Networks
    Suite - 115, Ansals Majestic Tower,
    Vikaspuri, New Delhi - 110018, India
    Telephone Nos: +91-11-41586840 / 41586940
    Mobile No: +91-9811203268
    Fax No: +91-11-41586740
    E-Mail: info@prudentnetworks.com
     
    Sign up E-Newsletter Spam-Free Zone
     
     
    BlogWORDPRESSFACEBOOKTWITTERORKUTMYSPACELINKEDINIDENTIFRIENDFEED
        
    Copyright 2010 Prudent Networks. All rights reserved.
         
    Testimonials